General Information

  • ID:  hor007134
  • Uniprot ID:  Q16552??25-155)
  • Protein name:  Interleukin-17A
  • Gene name:  NA
  • Organism:  Homo sapiens
  • Family:  IL-17 family
  • Source:  Human
  • Expression:  Expressed in memory Th17 cells
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  NA
  • GO BP:  GO:0005125 cytokine activity; GO:0046982 protein heterodimerization activity; GO:0042803 protein homodimerization activity
  • GO CC:  GO:0045944 positive regulation of transcription by RNA polymerase II; GO:0071347 cellular response to interleukin-1; GO:0043616 keratinocyte proliferation; GO:0106015 negative regulation of inflammatory response to wounding; GO:0007219 Notch signaling pathway; GO:0002225 positive regulation of antimicrobial peptide production; GO:1903348 positive regulation of bicellular tight junction assembly; GO:2000340 positive regulation of chemokine (C-X-C motif) ligand 1 production; GO:1900017 positive regulation of cytokine production involved in inflammatory response; GO:0032731 positive regulation of interleukin-1 beta production; GO:0032735 positive regulation of interleukin-12 production; GO:0032739 positive regulation of interleukin-16 production; GO:0032747 positive regulation of interleukin-23 production; GO:0032755 positive regulation of interleukin-6 production; GO:0009611 response to wounding; GO:0032760 positive regulation of tumor necrosis factor production; GO:0045672 positive regu

Sequence Information

  • Sequence:  ITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
  • Length:  131
  • Propeptide:  MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
  • Signal peptide:  MTPGKTSLVSLLLLLSLEAIVKA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA